BAT5 polyclonal antibody (A01)
  • BAT5 polyclonal antibody (A01)

BAT5 polyclonal antibody (A01)

Ref: AB-H00007920-A01
BAT5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BAT5.
Información adicional
Size 50 uL
Gene Name BAT5
Gene Alias D6S82E|NG26
Gene Description HLA-B associated transcript 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BAT5 (NP_066983, 459 a.a. ~ 556 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7920

Enviar uma mensagem


BAT5 polyclonal antibody (A01)

BAT5 polyclonal antibody (A01)