BAT1 polyclonal antibody (A01)
  • BAT1 polyclonal antibody (A01)

BAT1 polyclonal antibody (A01)

Ref: AB-H00007919-A01
BAT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BAT1.
Información adicional
Size 50 uL
Gene Name BAT1
Gene Alias D6S81E|DDX39B|UAP56
Gene Description HLA-B associated transcript 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BAT1 (NP_004631, 329 a.a. ~ 428 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7919

Enviar uma mensagem


BAT1 polyclonal antibody (A01)

BAT1 polyclonal antibody (A01)