C5orf18 monoclonal antibody (M04), clone 3G11
  • C5orf18 monoclonal antibody (M04), clone 3G11

C5orf18 monoclonal antibody (M04), clone 3G11

Ref: AB-H00007905-M04
C5orf18 monoclonal antibody (M04), clone 3G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C5orf18.
Información adicional
Size 100 ug
Gene Name REEP5
Gene Alias C5orf18|D5S346|DP1|MGC70440|TB2
Gene Description receptor accessory protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7905
Clone Number 3G11
Iso type IgG2a Kappa

Enviar uma mensagem


C5orf18 monoclonal antibody (M04), clone 3G11

C5orf18 monoclonal antibody (M04), clone 3G11