ST8SIA4 monoclonal antibody (M03), clone 1H5
  • ST8SIA4 monoclonal antibody (M03), clone 1H5

ST8SIA4 monoclonal antibody (M03), clone 1H5

Ref: AB-H00007903-M03
ST8SIA4 monoclonal antibody (M03), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ST8SIA4.
Información adicional
Size 100 ug
Gene Name ST8SIA4
Gene Alias MGC34450|MGC61459|PST|PST1|SIAT8D|ST8SIA-IV
Gene Description ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,ELISA
Immunogen Prot. Seq MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST8SIA4 (AAH27866, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7903
Clone Number 1H5
Iso type IgG2a Kappa

Enviar uma mensagem


ST8SIA4 monoclonal antibody (M03), clone 1H5

ST8SIA4 monoclonal antibody (M03), clone 1H5