SEMA3B purified MaxPab rabbit polyclonal antibody (D01P)
  • SEMA3B purified MaxPab rabbit polyclonal antibody (D01P)

SEMA3B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007869-D01P
SEMA3B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SEMA3B protein.
Información adicional
Size 100 ug
Gene Name SEMA3B
Gene Alias FLJ34863|LUCA-1|SEMA5|SEMAA|SemA|semaV
Gene Description sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNFVKLLHAYNRTHLLACGTGAFHPTCAFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSIFQGSAVCVYSMNDVRRAFLGPFAHKEGPMHQWVSYQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEMA3B (AAH09113.1, 1 a.a. ~ 635 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7869

Enviar uma mensagem


SEMA3B purified MaxPab rabbit polyclonal antibody (D01P)

SEMA3B purified MaxPab rabbit polyclonal antibody (D01P)