SEMA3B polyclonal antibody (A01)
  • SEMA3B polyclonal antibody (A01)

SEMA3B polyclonal antibody (A01)

Ref: AB-H00007869-A01
SEMA3B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA3B.
Información adicional
Size 50 uL
Gene Name SEMA3B
Gene Alias FLJ34863|LUCA-1|SEMA5|SEMAA|SemA|semaV
Gene Description sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA3B (NP_004627, 651 a.a. ~ 748 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7869

Enviar uma mensagem


SEMA3B polyclonal antibody (A01)

SEMA3B polyclonal antibody (A01)