PAX8 monoclonal antibody (M10), clone 3G11
  • PAX8 monoclonal antibody (M10), clone 3G11

PAX8 monoclonal antibody (M10), clone 3G11

Ref: AB-H00007849-M10
PAX8 monoclonal antibody (M10), clone 3G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAX8.
Información adicional
Size 100 ug
Gene Name PAX8
Gene Alias -
Gene Description paired box 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7849
Clone Number 3G11
Iso type IgG2b Kappa

Enviar uma mensagem


PAX8 monoclonal antibody (M10), clone 3G11

PAX8 monoclonal antibody (M10), clone 3G11