PXDN polyclonal antibody (A01)
  • PXDN polyclonal antibody (A01)

PXDN polyclonal antibody (A01)

Ref: AB-H00007837-A01
PXDN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PXDN.
Información adicional
Size 50 uL
Gene Name PXDN
Gene Alias D2S448|D2S448E|KIAA0230|MG50|PRG2|PXN|VPO
Gene Description peroxidasin homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PXDN (XP_056455, 1452 a.a. ~ 1561 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7837

Enviar uma mensagem


PXDN polyclonal antibody (A01)

PXDN polyclonal antibody (A01)