BTG2 monoclonal antibody (M01), clone 1A5
  • BTG2 monoclonal antibody (M01), clone 1A5

BTG2 monoclonal antibody (M01), clone 1A5

Ref: AB-H00007832-M01
BTG2 monoclonal antibody (M01), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BTG2.
Información adicional
Size 100 ug
Gene Name BTG2
Gene Alias MGC126063|MGC126064|PC3|TIS21
Gene Description BTG family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7832
Clone Number 1A5
Iso type IgG1 Kappa

Enviar uma mensagem


BTG2 monoclonal antibody (M01), clone 1A5

BTG2 monoclonal antibody (M01), clone 1A5