BTG2 polyclonal antibody (A01)
  • BTG2 polyclonal antibody (A01)

BTG2 polyclonal antibody (A01)

Ref: AB-H00007832-A01
BTG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BTG2.
Información adicional
Size 50 uL
Gene Name BTG2
Gene Alias MGC126063|MGC126064|PC3|TIS21
Gene Description BTG family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7832

Enviar uma mensagem


BTG2 polyclonal antibody (A01)

BTG2 polyclonal antibody (A01)