DAP3 monoclonal antibody (M01), clone 3B7
  • DAP3 monoclonal antibody (M01), clone 3B7

DAP3 monoclonal antibody (M01), clone 3B7

Ref: AB-H00007818-M01
DAP3 monoclonal antibody (M01), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DAP3.
Información adicional
Size 100 ug
Gene Name DAP3
Gene Alias DAP-3|DKFZp686G12159|MGC126058|MGC126059|MRP-S29|MRPS29|bMRP-10
Gene Description death associated protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq TDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAP3 (NP_004623, 237 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7818
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


DAP3 monoclonal antibody (M01), clone 3B7

DAP3 monoclonal antibody (M01), clone 3B7