DAP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • DAP3 purified MaxPab rabbit polyclonal antibody (D01P)

DAP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007818-D01P
DAP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DAP3 protein.
Información adicional
Size 100 ug
Gene Name DAP3
Gene Alias DAP-3|DKFZp686G12159|MGC126058|MGC126059|MRP-S29|MRPS29|bMRP-10
Gene Description death associated protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNISPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCHVIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DAP3 (NP_004623.1, 1 a.a. ~ 398 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7818

Enviar uma mensagem


DAP3 purified MaxPab rabbit polyclonal antibody (D01P)

DAP3 purified MaxPab rabbit polyclonal antibody (D01P)