CSDE1 polyclonal antibody (A01)
  • CSDE1 polyclonal antibody (A01)

CSDE1 polyclonal antibody (A01)

Ref: AB-H00007812-A01
CSDE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CSDE1.
Información adicional
Size 50 uL
Gene Name CSDE1
Gene Alias D1S155E|DKFZp779B0247|DKFZp779J1455|FLJ26882|RP5-1000E10.3|UNR
Gene Description cold shock domain containing E1, RNA-binding
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq HVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSDE1 (NP_009089, 670 a.a. ~ 765 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7812

Enviar uma mensagem


CSDE1 polyclonal antibody (A01)

CSDE1 polyclonal antibody (A01)