BSND purified MaxPab mouse polyclonal antibody (B01P)
  • BSND purified MaxPab mouse polyclonal antibody (B01P)

BSND purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007809-B01P
BSND purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BSND protein.
Información adicional
Size 50 ug
Gene Name BSND
Gene Alias BART|MGC119283|MGC119284|MGC119285
Gene Description Bartter syndrome, infantile, with sensorineural deafness (Barttin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P
Immunogen Prot. Seq MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BSND (NP_476517.1, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7809

Enviar uma mensagem


BSND purified MaxPab mouse polyclonal antibody (B01P)

BSND purified MaxPab mouse polyclonal antibody (B01P)