LRP8 monoclonal antibody (M01), clone 3H2
  • LRP8 monoclonal antibody (M01), clone 3H2

LRP8 monoclonal antibody (M01), clone 3H2

Ref: AB-H00007804-M01
LRP8 monoclonal antibody (M01), clone 3H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LRP8.
Información adicional
Size 100 ug
Gene Name LRP8
Gene Alias APOER2|HSZ75190|MCI1
Gene Description low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRP8 (NP_004622, 83 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7804
Clone Number 3H2
Iso type IgG1 Kappa

Enviar uma mensagem


LRP8 monoclonal antibody (M01), clone 3H2

LRP8 monoclonal antibody (M01), clone 3H2