ZYX polyclonal antibody (A01)
  • ZYX polyclonal antibody (A01)

ZYX polyclonal antibody (A01)

Ref: AB-H00007791-A01
50 uL

Información del producto

ZYX polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ZYX
Gene Alias ESP-2|HED-2
Gene Description zyxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAPRPSPAISVSVSAPAFYAPQEKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZYX (AAH08743, 1 a.a. ~ 572 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7791

Enviar uma mensagem


ZYX polyclonal antibody (A01)

ZYX polyclonal antibody (A01)