ZP2 monoclonal antibody (M01), clone 2B9
  • ZP2 monoclonal antibody (M01), clone 2B9

ZP2 monoclonal antibody (M01), clone 2B9

Ref: AB-H00007783-M01
ZP2 monoclonal antibody (M01), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZP2.
Información adicional
Size 100 ug
Gene Name ZP2
Gene Alias ZPA
Gene Description zona pellucida glycoprotein 2 (sperm receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZP2 (NP_003451.1, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7783
Clone Number 2B9
Iso type IgG2a Kappa

Enviar uma mensagem


ZP2 monoclonal antibody (M01), clone 2B9

ZP2 monoclonal antibody (M01), clone 2B9