Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZNF232 monoclonal antibody (M06), clone 1F8
Abnova
ZNF232 monoclonal antibody (M06), clone 1F8
Ref: AB-H00007775-M06
ZNF232 monoclonal antibody (M06), clone 1F8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZNF232.
Información adicional
Size
100 ug
Gene Name
ZNF232
Gene Alias
ZSCAN11
Gene Description
zinc finger protein 232
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq
EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZNF232 (NP_055334.2, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7775
Clone Number
1F8
Iso type
IgG2a Kappa
Enviar uma mensagem
ZNF232 monoclonal antibody (M06), clone 1F8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*