ZNF207 monoclonal antibody (M09), clone 1A2
  • ZNF207 monoclonal antibody (M09), clone 1A2

ZNF207 monoclonal antibody (M09), clone 1A2

Ref: AB-H00007756-M09
ZNF207 monoclonal antibody (M09), clone 1A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF207.
Información adicional
Size 100 ug
Gene Name ZNF207
Gene Alias DKFZp761N202
Gene Description zinc finger protein 207
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF207 (NP_003448, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7756
Clone Number 1A2
Iso type IgG2b Kappa

Enviar uma mensagem


ZNF207 monoclonal antibody (M09), clone 1A2

ZNF207 monoclonal antibody (M09), clone 1A2