ZNF174 monoclonal antibody (M01), clone 2D7-E9
  • ZNF174 monoclonal antibody (M01), clone 2D7-E9

ZNF174 monoclonal antibody (M01), clone 2D7-E9

Ref: AB-H00007727-M01
ZNF174 monoclonal antibody (M01), clone 2D7-E9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ZNF174.
Información adicional
Size 100 ug
Gene Name ZNF174
Gene Alias ZSCAN8
Gene Description zinc finger protein 174
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF174 (AAH00876, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7727
Clone Number 2D7-E9
Iso type IgG2b kappa

Enviar uma mensagem


ZNF174 monoclonal antibody (M01), clone 2D7-E9

ZNF174 monoclonal antibody (M01), clone 2D7-E9