ZNF154 polyclonal antibody (A01)
  • ZNF154 polyclonal antibody (A01)

ZNF154 polyclonal antibody (A01)

Ref: AB-H00007710-A01
ZNF154 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNF154.
Información adicional
Size 50 uL
Gene Name ZNF154
Gene Alias MGC176628|MGC176661|pHZ-92
Gene Description zinc finger protein 154
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAVATLRTPTQGTVTFEDVAVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF154 (NP_003435, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7710

Enviar uma mensagem


ZNF154 polyclonal antibody (A01)

ZNF154 polyclonal antibody (A01)