Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZBTB16 monoclonal antibody (M02), clone 1F10
Abnova
ZBTB16 monoclonal antibody (M02), clone 1F10
Ref: AB-H00007704-M02
ZBTB16 monoclonal antibody (M02), clone 1F10
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZBTB16.
Información adicional
Size
100 ug
Gene Name
ZBTB16
Gene Alias
PLZF|ZNF145
Gene Description
zinc finger and BTB domain containing 16
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7704
Clone Number
1F10
Iso type
IgG2a Kappa
Enviar uma mensagem
ZBTB16 monoclonal antibody (M02), clone 1F10
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*