ZNF133 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF133 purified MaxPab mouse polyclonal antibody (B01P)

ZNF133 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007692-B01P
ZNF133 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF133 protein.
Información adicional
Size 50 ug
Gene Name ZNF133
Gene Alias ZNF150|pHZ-13|pHZ-66
Gene Description zinc finger protein 133
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELITQLEQGKETWREEKKCSPATCPDPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSSRNGLRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLSHQRIHSGEKPYVCGVCEKGFSLKKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF133 (AAH01887, 1 a.a. ~ 653 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7692

Enviar uma mensagem


ZNF133 purified MaxPab mouse polyclonal antibody (B01P)

ZNF133 purified MaxPab mouse polyclonal antibody (B01P)