ZNF84 MaxPab mouse polyclonal antibody (B01)
  • ZNF84 MaxPab mouse polyclonal antibody (B01)

ZNF84 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00007637-B01
ZNF84 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF84 protein.
Información adicional
Size 50 uL
Gene Name ZNF84
Gene Alias HPF2
Gene Description zinc finger protein 84
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTMLQESFSFDDLSVDFTQKEWQLLDPSQKNLYKDVMLENYSSLVSLGYEVMKPDVIFKLEQGEEPWVGDGEIPSSDSPEVWKVDGNMMWHQDNQDKLKIIKRGHECDAFGKNFNLNMNFVPLRKSNSEGDLDGLILKHHLDLLIPKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYYDCDKYKESYKKSQIIIYHRNRLGEKLYECSECRKRFSKKPSLIKHQSRHIRDIAFGCGNCGKTFPQKSQFITHHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF84 (AAH62552.1, 1 a.a. ~ 738 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7637

Enviar uma mensagem


ZNF84 MaxPab mouse polyclonal antibody (B01)

ZNF84 MaxPab mouse polyclonal antibody (B01)