ZNF42 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF42 purified MaxPab mouse polyclonal antibody (B01P)

ZNF42 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007593-B01P
ZNF42 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF42 protein.
Información adicional
Size 50 ug
Gene Name MZF1
Gene Alias MZF-1|MZF1B|ZNF42|ZSCAN6|Zfp98
Gene Description myeloid zinc finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQEALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVDGLRREPGGPRRWVTVQVQGQEVLSEKMEPSSFQPLPETEPPTPEPGPKTPPRTMQESPLGLQVKEESEVTEDSDFLESGPLAATQESVPTLLPEEAQRCGTVLDQIFPHSKTGPEGPSWREHPRALWHEEAGGIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF42 (NP_003413.2, 1 a.a. ~ 734 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7593

Enviar uma mensagem


ZNF42 purified MaxPab mouse polyclonal antibody (B01P)

ZNF42 purified MaxPab mouse polyclonal antibody (B01P)