ZSCAN20 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZSCAN20 purified MaxPab rabbit polyclonal antibody (D01P)

ZSCAN20 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007579-D01P
ZSCAN20 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZSCAN20 protein.
Información adicional
Size 100 ug
Gene Name ZSCAN20
Gene Alias KOX29|ZFP-31|ZNF31|ZNF360
Gene Description zinc finger and SCAN domain containing 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEASRQRFRQFQYRDAAGPHEAFSQLWALCCRWLRPEIRLKEQILELLVLEQFLTILPREVQTWVQARHPESGEEAVALVEDWHRETRTAGQSGLELHTEETRPLKTGEEAQSFQLQPVDPWPEGQSQKKGVKNTCPDLPNHLNAEVAPQPLKESGVPVSKPSNTSEKEQGPEFWGLSLINSGKRSTADYSLDNEPAQALTWRDSRAWE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZSCAN20 (AAH11404.1, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7579

Enviar uma mensagem


ZSCAN20 purified MaxPab rabbit polyclonal antibody (D01P)

ZSCAN20 purified MaxPab rabbit polyclonal antibody (D01P)