ZNF182 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF182 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF182 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007569-D01P
ZNF182 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF182 protein.
Información adicional
Size 100 ug
Gene Name ZNF182
Gene Alias HHZ150|KOX14|MGC125383|MGC131713|ZNF21|Zfp182
Gene Description zinc finger protein 182
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAKPQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKLFFHTEYEKTNPGMKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF182 (NP_001007089.1, 1 a.a. ~ 620 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7569

Enviar uma mensagem


ZNF182 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF182 purified MaxPab rabbit polyclonal antibody (D01P)