ZNF21 MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human ZNF21 protein.

AB-H00007569-B01P

New product

ZNF21 MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name ZNF182
Gene Alias HHZ150|KOX14|MGC125383|MGC131713|ZNF21|Zfp182
Gene Description zinc finger protein 182
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAKPQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKLFFHTEYEKTNPGMKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF21 (NP_001007089.1, 1 a.a. ~ 620 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7569

More info

Mouse polyclonal antibody raised against a full-length human ZNF21 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human ZNF21 protein.

Mouse polyclonal antibody raised against a full-length human ZNF21 protein.