ZNF12 monoclonal antibody (M04), clone 8H7
  • ZNF12 monoclonal antibody (M04), clone 8H7

ZNF12 monoclonal antibody (M04), clone 8H7

Ref: AB-H00007559-M04
ZNF12 monoclonal antibody (M04), clone 8H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF12.
Información adicional
Size 100 ug
Gene Name ZNF12
Gene Alias GIOT-3|HZF11|KOX3|ZNF325
Gene Description zinc finger protein 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VEGEFLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISSDGSYARMKADECSGCGKSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF12 (NP_057349, 69 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7559
Clone Number 8H7
Iso type IgG2a Kappa

Enviar uma mensagem


ZNF12 monoclonal antibody (M04), clone 8H7

ZNF12 monoclonal antibody (M04), clone 8H7