ZNF12 polyclonal antibody (A01)
  • ZNF12 polyclonal antibody (A01)

ZNF12 polyclonal antibody (A01)

Ref: AB-H00007559-A01
ZNF12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNF12.
Información adicional
Size 50 uL
Gene Name ZNF12
Gene Alias GIOT-3|HZF11|KOX3|ZNF325
Gene Description zinc finger protein 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VEGEFLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISSDGSYARMKADECSGCGKSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF12 (NP_057349, 69 a.a. ~ 175 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7559

Enviar uma mensagem


ZNF12 polyclonal antibody (A01)

ZNF12 polyclonal antibody (A01)