ZIC2 monoclonal antibody (M08), clone 3H7
  • ZIC2 monoclonal antibody (M08), clone 3H7

ZIC2 monoclonal antibody (M08), clone 3H7

Ref: AB-H00007546-M08
ZIC2 monoclonal antibody (M08), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ZIC2.
Información adicional
Size 100 ug
Gene Name ZIC2
Gene Alias HPE5
Gene Description Zic family member 2 (odd-paired homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC2 (NP_009060, 130 a.a. ~ 220 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7546
Clone Number 3H7
Iso type IgG2a Kappa

Enviar uma mensagem


ZIC2 monoclonal antibody (M08), clone 3H7

ZIC2 monoclonal antibody (M08), clone 3H7