Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZIC1 monoclonal antibody (M06), clone 4D2
Abnova
ZIC1 monoclonal antibody (M06), clone 4D2
Ref: AB-H00007545-M06
ZIC1 monoclonal antibody (M06), clone 4D2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant ZIC1.
Información adicional
Size
100 ug
Gene Name
ZIC1
Gene Alias
ZIC|ZNF201
Gene Description
Zic family member 1 (odd-paired homolog, Drosophila)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7545
Clone Number
4D2
Iso type
IgG2a Kappa
Enviar uma mensagem
ZIC1 monoclonal antibody (M06), clone 4D2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*