ZIC1 monoclonal antibody (M03), clone 4D11 View larger

Mouse monoclonal antibody raised against a partial recombinant ZIC1.

AB-H00007545-M03

New product

ZIC1 monoclonal antibody (M03), clone 4D11

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name ZIC1
Gene Alias ZIC|ZNF201
Gene Description Zic family member 1 (odd-paired homolog, Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZIC1 (NP_003403, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7545
Clone Number 4D11
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant ZIC1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant ZIC1.

Mouse monoclonal antibody raised against a partial recombinant ZIC1.