SF1 polyclonal antibody (A01)
  • SF1 polyclonal antibody (A01)

SF1 polyclonal antibody (A01)

Ref: AB-H00007536-A01
SF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SF1.
Información adicional
Size 50 uL
Gene Name SF1
Gene Alias D11S636|ZFM1|ZNF162
Gene Description splicing factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7536

Enviar uma mensagem


SF1 polyclonal antibody (A01)

SF1 polyclonal antibody (A01)