Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
YWHAE polyclonal antibody (A01)
Abnova
YWHAE polyclonal antibody (A01)
Ref: AB-H00007531-A01
YWHAE polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length recombinant YWHAE.
Información adicional
Size
50 uL
Gene Name
YWHAE
Gene Alias
14-3-3E|FLJ45465|KCIP-1|MDCR|MDS
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
YWHAE (AAH00179, 1 a.a. ~ 255 a.a) full-length recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
7531
Enviar uma mensagem
YWHAE polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*