XRCC1 purified MaxPab rabbit polyclonal antibody (D01P)
  • XRCC1 purified MaxPab rabbit polyclonal antibody (D01P)

XRCC1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007515-D01P
XRCC1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human XRCC1 protein.
Información adicional
Size 100 ug
Gene Name XRCC1
Gene Alias RCC
Gene Description X-ray repair complementing defective repair in Chinese hamster cells 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XRCC1 (AAH23593.1, 1 a.a. ~ 633 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7515

Enviar uma mensagem


XRCC1 purified MaxPab rabbit polyclonal antibody (D01P)

XRCC1 purified MaxPab rabbit polyclonal antibody (D01P)