XPNPEP1 purified MaxPab mouse polyclonal antibody (B01P)
  • XPNPEP1 purified MaxPab mouse polyclonal antibody (B01P)

XPNPEP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007511-B01P
XPNPEP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human XPNPEP1 protein.
Información adicional
Size 50 ug
Gene Name XPNPEP1
Gene Alias SAMP|XPNPEP|XPNPEPL|XPNPEPL1
Gene Description X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XPNPEP1 (NP_065116.2, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7511

Enviar uma mensagem


XPNPEP1 purified MaxPab mouse polyclonal antibody (B01P)

XPNPEP1 purified MaxPab mouse polyclonal antibody (B01P)