XPA purified MaxPab rabbit polyclonal antibody (D01P)
  • XPA purified MaxPab rabbit polyclonal antibody (D01P)

XPA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007507-D01P
XPA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human XPA protein.
Información adicional
Size 100 ug
Gene Name XPA
Gene Alias XP1|XPAC
Gene Description xeroderma pigmentosum, complementation group A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen XPA (NP_000371.1, 1 a.a. ~ 273 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7507

Enviar uma mensagem


XPA purified MaxPab rabbit polyclonal antibody (D01P)

XPA purified MaxPab rabbit polyclonal antibody (D01P)