WT1 monoclonal antibody (M01), clone 2H4
  • WT1 monoclonal antibody (M01), clone 2H4

WT1 monoclonal antibody (M01), clone 2H4

Ref: AB-H00007490-M01
WT1 monoclonal antibody (M01), clone 2H4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant WT1.
Información adicional
Size 100 ug
Gene Name WT1
Gene Alias GUD|WAGR|WIT-2|WT33
Gene Description Wilms tumor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WT1 (NP_000369.3, 349 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7490
Clone Number 2H4
Iso type IgG2b Kappa

Enviar uma mensagem


WT1 monoclonal antibody (M01), clone 2H4

WT1 monoclonal antibody (M01), clone 2H4