WT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • WT1 purified MaxPab rabbit polyclonal antibody (D01P)

WT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007490-D01P
WT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WT1 protein.
Información adicional
Size 100 ug
Gene Name WT1
Gene Alias GUD|WAGR|WIT-2|WT33
Gene Description Wilms tumor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WT1 (AAH32861.1, 1 a.a. ~ 302 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7490

Enviar uma mensagem


WT1 purified MaxPab rabbit polyclonal antibody (D01P)

WT1 purified MaxPab rabbit polyclonal antibody (D01P)