WRB polyclonal antibody (A01)
  • WRB polyclonal antibody (A01)

WRB polyclonal antibody (A01)

Ref: AB-H00007485-A01
WRB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant WRB.
Información adicional
Size 50 uL
Gene Name WRB
Gene Alias CHD5
Gene Description tryptophan rich basic protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WRB (NP_004618, 29 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7485

Enviar uma mensagem


WRB polyclonal antibody (A01)

WRB polyclonal antibody (A01)