Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
WNT8A purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
WNT8A purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00007478-D01P
WNT8A purified MaxPab rabbit polyclonal antibody (D01P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human WNT8A protein.
Información adicional
Size
100 ug
Gene Name
WNT8A
Gene Alias
WNT8D
Gene Description
wingless-type MMTV integration site family, member 8A
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEES
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
WNT8A (NP_490645.1, 1 a.a. ~ 351 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7478
Enviar uma mensagem
WNT8A purified MaxPab rabbit polyclonal antibody (D01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*