WHSC2 purified MaxPab mouse polyclonal antibody (B01P)
  • WHSC2 purified MaxPab mouse polyclonal antibody (B01P)

WHSC2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007469-B01P
WHSC2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human WHSC2 protein.
Información adicional
Size 50 ug
Gene Name WHSC2
Gene Alias FLJ10442|FLJ25112|NELF-A|NELFA|P/OKcl.15
Gene Description Wolf-Hirschhorn syndrome candidate 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRKERGVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WHSC2 (NP_005654.2, 1 a.a. ~ 528 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7469

Enviar uma mensagem


WHSC2 purified MaxPab mouse polyclonal antibody (B01P)

WHSC2 purified MaxPab mouse polyclonal antibody (B01P)