Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
WEE1 monoclonal antibody (M01A), clone 5B6
Abnova
WEE1 monoclonal antibody (M01A), clone 5B6
Ref: AB-H00007465-M01A
WEE1 monoclonal antibody (M01A), clone 5B6
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant WEE1.
Información adicional
Size
200 uL
Gene Name
WEE1
Gene Alias
DKFZp686I18166|FLJ16446|WEE1A|WEE1hu
Gene Description
WEE1 homolog (S. pombe)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
SNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
WEE1 (NP_003381, 289 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
7465
Clone Number
5B6
Iso type
IgM Kappa
Enviar uma mensagem
WEE1 monoclonal antibody (M01A), clone 5B6
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*