WARS purified MaxPab mouse polyclonal antibody (B01P)
  • WARS purified MaxPab mouse polyclonal antibody (B01P)

WARS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007453-B01P
WARS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human WARS protein.
Información adicional
Size 50 ug
Gene Name WARS
Gene Alias GAMMA-2|IFI53|IFP53
Gene Description tryptophanyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WARS (NP_004175.2, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7453

Enviar uma mensagem


WARS purified MaxPab mouse polyclonal antibody (B01P)

WARS purified MaxPab mouse polyclonal antibody (B01P)