Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VSNL1 polyclonal antibody (A01)
Abnova
VSNL1 polyclonal antibody (A01)
Ref: AB-H00007447-A01
VSNL1 polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length recombinant VSNL1.
Información adicional
Size
50 uL
Gene Name
VSNL1
Gene Alias
HLP3|HPCAL3|HUVISL1|VILIP|VILIP-1
Gene Description
visinin-like 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VSNL1 (AAH22012, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
7447
Enviar uma mensagem
VSNL1 polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*