VRK1 polyclonal antibody (A01)
  • VRK1 polyclonal antibody (A01)

VRK1 polyclonal antibody (A01)

Ref: AB-H00007443-A01
VRK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VRK1.
Información adicional
Size 50 uL
Gene Name VRK1
Gene Alias MGC117401|MGC138280|MGC142070
Gene Description vaccinia related kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VRK1 (NP_003375, 287 a.a. ~ 396 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7443

Enviar uma mensagem


VRK1 polyclonal antibody (A01)

VRK1 polyclonal antibody (A01)