TRPV1 monoclonal antibody (M02), clone 1A8
  • TRPV1 monoclonal antibody (M02), clone 1A8

TRPV1 monoclonal antibody (M02), clone 1A8

Ref: AB-H00007442-M02
TRPV1 monoclonal antibody (M02), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRPV1.
Información adicional
Size 100 ug
Gene Name TRPV1
Gene Alias DKFZp434K0220|VR1
Gene Description transient receptor potential cation channel, subfamily V, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7442
Clone Number 1A8
Iso type IgG2a Kappa

Enviar uma mensagem


TRPV1 monoclonal antibody (M02), clone 1A8

TRPV1 monoclonal antibody (M02), clone 1A8