TRPV1 monoclonal antibody (M01A), clone 1F5
  • TRPV1 monoclonal antibody (M01A), clone 1F5

TRPV1 monoclonal antibody (M01A), clone 1F5

Ref: AB-H00007442-M01A
TRPV1 monoclonal antibody (M01A), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRPV1.
Información adicional
Size 200 uL
Gene Name TRPV1
Gene Alias DKFZp434K0220|VR1
Gene Description transient receptor potential cation channel, subfamily V, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 7442
Clone Number 1F5
Iso type IgG1 Kappa

Enviar uma mensagem


TRPV1 monoclonal antibody (M01A), clone 1F5

TRPV1 monoclonal antibody (M01A), clone 1F5