View larger
Mouse monoclonal antibody raised against a full-length recombinant VIL2.
AB-H00007430-M04
New product
EZR monoclonal antibody (M04), clone 1E11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | EZR |
| Gene Alias | CVIL|CVL|DKFZp762H157|FLJ26216|MGC1584|VIL2 |
| Gene Description | ezrin |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce |
| Immunogen Prot. Seq | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKF |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | EZR (AAH13903, 1 a.a. ~ 586 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 7430 |
| Clone Number | 1E11 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant VIL2.